PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0382s0350.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 702aa    MW: 77275.9 Da    PI: 5.8598
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0382s0350.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS312.97e-963467005374
                    GRAS   5 LlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                             + ++Ae +++g+   aq +Larl+++ + p g+p qR a+yf+ AL+  l++      +  +   ++  n + ++ a+k fse+sPi
  SapurV1A.0382s0350.2.p 346 ICQAAELIETGNPVHAQGILARLNHQlSLPIGKPYQRTAFYFKDALQLLLHS------SNNSNLMDTACNLIFKIGAYKSFSEISPI 426
                             689*********************99788999*******************9......3333334444679**************** PP

                    GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfe 177
                             l+f+++t+Nq +lea+eg+er+Hi+Dfdi++G+QW++L+q+La +++g+psl+iT+++sp+s+++ el  t+e+L+ fA+e+++pfe
  SapurV1A.0382s0350.2.p 427 LQFANFTCNQVLLEAFEGSERIHIVDFDIGYGGQWASLMQELALKAGGAPSLKITAFASPSSHDELELGFTQENLRIFASEMNMPFE 513
                             *************************************************************************************** PP

                    GRAS 178 fnvlvakrledleleeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                              ++l  ++l +   + L   ++++E++aVnl +   ++ +++ +l+     vL++vk+lsPkvvv  ++ +d+++ +F++++ +a++
  SapurV1A.0382s0350.2.p 514 LEILSLESLGSG-SWPLppCTSEKEVTAVNLPIG--SFSNDPSTLPV----VLRFVKQLSPKVVVSLDRGCDRSDLPFAHHVNHAIQ 593
                             ***955555554.5666434555*********95..55556666666....************************************ PP

                    GRAS 263 yysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg 348
                              ys+l++sl ++++  + ++ +k+Er+l+++ i+++v  +++      e+   Wr  + ++GF p+++s+++++qa++l+++++++g
  SapurV1A.0382s0350.2.p 594 SYSTLLESLdAVNV--HPDALQKIERFLVQPGIEKLVLGRHRC----PERTPPWRTLFLQSGFIPLTFSNFTESQAEYLVQRTPVRG 674
                             *********55554..5578899***************99998....9999************************************ PP

                    GRAS 349 yrveeesgslvlgWkdrpLvsvSaWr 374
                             ++ve+++ slvl+W++  Lvs+SaWr
  SapurV1A.0382s0350.2.p 675 FHVEKRQSSLVLCWQRMDLVSASAWR 700
                             *************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.168316680IPR005202Transcription factor GRAS
PfamPF035142.4E-93346700IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MKAMPLPSED FQGKGVFDFS SSTTSSPDSL HQYHRRWQNN NSKESCGFFV GGAEPTSVLD  60
TISRQSPPTS SSTLSSSQGG GGGGGASTDT TNDAAAAGGS IPCLDEKCGQ QLGMEDWESV  120
LPGSPSQEQS ILRLIMGDIE DPSAGLNKLL QSGSRSLEME HASGFGVVDQ VFGFDISQMS  180
SASANLVANN NSIDPSSIHG INLLPGLFQQ QQQQTAFNQD EKPQILNPGM ISNQNQHQFV  240
QNPAMLLPFS YSQLQEHHNS QHFSSPPPSK RLNSGPVGVN YVPKVFDSRP PELFLPRQHQ  300
QQQQNHQFQM LQQQQQQKQG MIMNQKMATD ELVNQQQLQQ ATINPICQAA ELIETGNPVH  360
AQGILARLNH QLSLPIGKPY QRTAFYFKDA LQLLLHSSNN SNLMDTACNL IFKIGAYKSF  420
SEISPILQFA NFTCNQVLLE AFEGSERIHI VDFDIGYGGQ WASLMQELAL KAGGAPSLKI  480
TAFASPSSHD ELELGFTQEN LRIFASEMNM PFELEILSLE SLGSGSWPLP PCTSEKEVTA  540
VNLPIGSFSN DPSTLPVVLR FVKQLSPKVV VSLDRGCDRS DLPFAHHVNH AIQSYSTLLE  600
SLDAVNVHPD ALQKIERFLV QPGIEKLVLG RHRCPERTPP WRTLFLQSGF IPLTFSNFTE  660
SQAEYLVQRT PVRGFHVEKR QSSLVLCWQR MDLVSASAWR C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2937770037375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2118040.0AC211804.1 Populus trichocarpa clone POP017-B20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011033496.10.0PREDICTED: scarecrow-like protein 22 isoform X1
RefseqXP_011033489.10.0PREDICTED: scarecrow-like protein 22 isoform X1
SwissprotO813161e-148SCL6_ARATH; Scarecrow-like protein 6
TrEMBLU5FPJ80.0U5FPJ8_POPTR; Uncharacterized protein
STRINGPOPTR_0014s05910.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-138GRAS family protein